DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and APE3

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:172 Identity:39/172 - (22%)
Similarity:69/172 - (40%) Gaps:66/172 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 MEDRIAVDVYN------YAFLNWSYVEHGN--MLCNMEFAQEQARYGEGKVLNV----------- 103
            ::|:|.||..|      |...|:|..::|:  .:...:...:...|    :|||           
Yeast    75 LQDKIKVDDLNATAWDLYRLANYSTPDYGHPTRVIGSKGHNKTMEY----ILNVFDDMQDYYDVS 135

  Fly   104 -------TGRLIHITATD-----NFSDD--YACTPYIRGTLG--APIPDKG-------------- 138
                   :|::|....:|     :|::.  :|.:|.:.|.:|  ..||:.|              
Yeast   136 LQEFEALSGKIISFNLSDAETGKSFANTTAFALSPPVDGFVGKLVEIPNLGCEEKDYASVVPPRH 200

  Fly   139 -ETWIALVRRGRCTFEEKVKHVYQQNAAG------VIIYNDK 173
             |..|||:.||:|.|.:|      .|.||      |:||:::
Yeast   201 NEKQIALIERGKCPFGDK------SNLAGKFGFTAVVIYDNE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 33/151 (22%)
UPF0233 226..>258 CDD:299753
zf-RING_2 301..344 CDD:290367
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 38/169 (22%)
PA_ScAPY_like 155..284 CDD:239045 23/88 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.