DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT1G77830

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_177906.1 Gene:AT1G77830 / 844118 AraportID:AT1G77830 Length:185 Species:Arabidopsis thaliana


Alignment Length:135 Identity:31/135 - (22%)
Similarity:56/135 - (41%) Gaps:19/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 RGVRTISSLNRTSVLFVSISFIVLMIISLVWLIF-YYIQRFRYMQAKDQQSRNLCSVTKKAI--- 282
            ||..:.:.|::..|..|..||::....::...|| |.:..|.:   ||      ..:...|:   
plant    50 RGRGSKAGLSKAFVDLVGWSFMMQRESNISNQIFDYIVSNFSF---KD------LDIVPPAVWSR 105

  Fly   283 ----MKIPTKTGKFSDEKDLDSDCCAICIEAY-KPTDTIRILPCKHEFHKNCIDPWLIEHRTCPM 342
                :.|...|.:..|.......|| :|.:.| |..:.:....|.|.|:..||..:|:....||:
plant   106 SYRPVPIAPPTTEIVDCYQSSESCC-LCQKGYPKEDEIVHKTKCNHIFYGTCISRYLLHTPRCPV 169

  Fly   343 CKLDV 347
            |.:::
plant   170 CSVEL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 27/118 (23%)
RING-H2_RNF130-like 302..347 CDD:438330 14/45 (31%)
AT1G77830NP_177906.1 zf-RING_2 128..170 CDD:433370 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.