DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT1G71980

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_177343.2 Gene:AT1G71980 / 843529 AraportID:AT1G71980 Length:448 Species:Arabidopsis thaliana


Alignment Length:415 Identity:99/415 - (23%)
Similarity:160/415 - (38%) Gaps:81/415 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 DNFSDDYACTPYIRGT------------------LGAPIPDKGETW-IALVRRGRCTFEEKVKHV 159
            |:...::|  |.::||                  :..|.....||. ..|:.||.|:|||||:..
plant    34 DDIEANFA--PSVKGTGEIGVVYVAEPLDACQNLMNKPEQSSNETSPFVLIVRGGCSFEEKVRKA 96

  Fly   160 YQQNAAGVIIYNDKQVMQLEKMQIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGV 224
            .:......|||:::....|..|........|.||...:..|:.|...  .|:..|        .|
plant    97 QRAGFKAAIIYDNEDRGTLIAMAGNSGGIRIHAVFVTKETGEVLKEY--AGFPDT--------KV 151

  Fly   225 RTISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQS--RNLCSVTKKAIMKIPT 287
            ..|.|...::...:::|||.|:.:|.|....::::|.|..:...:.|  |....::::.:..:|:
plant   152 WLIPSFENSAWSIMAVSFISLLAMSAVLATCFFVRRHRIRRRTSRSSRVREFHGMSRRLVKAMPS 216

  Fly   288 KTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRT-CPMCKLDVLKFY 351
            .......|.:..:..||||:|.|...|.:|:|||.|:||..|:|.||...|| ||:||.|.....
plant   217 LIFSSFHEDNTTAFTCAICLEDYTVGDKLRLLPCCHKFHAACVDSWLTSWRTFCPVCKRDARTST 281

  Fly   352 GYVFLGSEESILEYQPDPPQG-----LALVEARDESADLNRSRDFVVDFPRVFVLDSGCVVGARE 411
            |               :||..     |:...:...|:.|:.|           |..|..::|...
plant   282 G---------------EPPASESTPLLSSAASSFTSSSLHSS-----------VRSSALLIGPSL 320

  Fly   412 MLFPCRI---PERSQSSLSLRQARDWVSLMSNKLEEQQGLRSMRND-EMQQQLL------SARES 466
            ...|..|   |..:.||. :||     |..|:.......:...|:. :::||..      |.|..
plant   321 GSLPTSISFSPAYASSSY-IRQ-----SFQSSSNRRSPPISVSRSSVDLRQQAASPSPSPSQRSY 379

  Fly   467 ARHRRSRSADGRYSTGCFGGRQRQP 491
            ..|..|..:.|..:...|..|...|
plant   380 ISHMASPQSLGYPTISPFNTRYMSP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 29/121 (24%)
UPF0233 226..>258 CDD:299753 8/31 (26%)
zf-RING_2 301..344 CDD:290367 22/43 (51%)
AT1G71980NP_177343.2 PA_C_RZF_like 11..161 CDD:239038 32/138 (23%)
zf-RING_2 230..274 CDD:290367 22/43 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.