DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and DEP

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_177247.1 Gene:DEP / 843430 AraportID:AT1G70910 Length:161 Species:Arabidopsis thaliana


Alignment Length:122 Identity:29/122 - (23%)
Similarity:47/122 - (38%) Gaps:41/122 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TFTLSHDLY--VYNLHLIRWFASFVGLDIMAPNYKPNILTFLAFFGLSISLIGEVYTVWYFWPIL 64
            :|..||||:  ::..:.: ..|.||.|                           |.|.|.|....
plant    59 SFRDSHDLFDGIFRCYAV-VIACFVVL---------------------------VETEWGFILKF 95

  Fly    65 DKLMESAAIFGVFIQGLAKFYIALRYRKFFEAMYNRLDLFHYEYRNHEKNNATLLLL 121
            .|::|..|  |   :|:.:.::|:..|.|.:.|..:.||...:      |.|:.|||
plant    96 SKVLEYWA--G---RGMLQIFVAVMTRAFPDYMTQKKDLLLLQ------NIASYLLL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 13/49 (27%)
HRD1 <237..>347 CDD:227568
RING-H2_RNF130-like 302..347 CDD:438330
DEPNP_177247.1 RING_Ubox 114..152 CDD:473075 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.