DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT1G63840

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_176569.1 Gene:AT1G63840 / 842687 AraportID:AT1G63840 Length:166 Species:Arabidopsis thaliana


Alignment Length:57 Identity:23/57 - (40%)
Similarity:38/57 - (66%) Gaps:3/57 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 KFSDEKDLDSDCCAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHR--TCPMCK 344
            :|||....:|:|||:|:..::..|.||.|. |:|.||:.|:|.|::.:.  |||:|:
plant    77 RFSDINRPESECCAVCLYDFENDDEIRRLTNCRHIFHRGCLDRWMMGYNQMTCPLCR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 23/57 (40%)
RING-H2_RNF130-like 302..347 CDD:438330 19/46 (41%)
AT1G63840NP_176569.1 RING-H2_RHA1-like 87..136 CDD:438483 19/47 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.