DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT1G63170

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_564810.1 Gene:AT1G63170 / 842621 AraportID:AT1G63170 Length:381 Species:Arabidopsis thaliana


Alignment Length:55 Identity:26/55 - (47%)
Similarity:36/55 - (65%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGY 353
            |::|| ||:.||:....:|.|||.|.||..|:|.||..:.|||:||.::||...|
plant   322 DAECC-ICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNY 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 23/47 (49%)
RING-H2_RNF130-like 302..347 CDD:438330 22/44 (50%)
AT1G63170NP_564810.1 RING_Ubox 324..366 CDD:473075 20/42 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.