DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT1G60360

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_176239.1 Gene:AT1G60360 / 842331 AraportID:AT1G60360 Length:327 Species:Arabidopsis thaliana


Alignment Length:49 Identity:20/49 - (40%)
Similarity:30/49 - (61%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDV 347
            |...|.:|:|.:........|||||.:||:||.|||..:.:||:|:.|:
plant   220 DMSQCTVCMEEFIVGGDATELPCKHIYHKDCIVPWLRLNNSCPICRRDL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 19/47 (40%)
RING-H2_RNF130-like 302..347 CDD:438330 18/44 (41%)
AT1G60360NP_176239.1 zinc_ribbon_9 24..56 CDD:433910
RAD18 199..>325 CDD:227719 20/49 (41%)
RING_Ubox 223..265 CDD:473075 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.