DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT1G49230

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_175349.1 Gene:AT1G49230 / 841346 AraportID:AT1G49230 Length:219 Species:Arabidopsis thaliana


Alignment Length:105 Identity:33/105 - (31%)
Similarity:56/105 - (53%) Gaps:8/105 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 VTKKAIMKIPTKTGKFSDEKD---LDSDCCAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEH 337
            |.:||:...  :|..:|.|.:   ||:: ||||:..:...:.:::|| |.|.||..|||.||..|
plant   105 VKRKALKSF--QTVSYSTELNLPGLDTE-CAICLSEFVAEERVKLLPTCHHGFHVRCIDKWLSSH 166

  Fly   338 RTCPMCKLDVLKFYGYVFLGSEESILEYQPDPPQGLALVE 377
            .:||.|:..:::....:...|:.|.|. ...|||...:::
plant   167 SSCPTCRHCLIQTCEKIADCSQTSSLN-STQPPQDSIILQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 27/73 (37%)
RING-H2_RNF130-like 302..347 CDD:438330 19/45 (42%)
AT1G49230NP_175349.1 RING-H2_EL5-like 130..173 CDD:438124 18/43 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.