DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT1G35630

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_174800.2 Gene:AT1G35630 / 840463 AraportID:AT1G35630 Length:318 Species:Arabidopsis thaliana


Alignment Length:303 Identity:75/303 - (24%)
Similarity:132/303 - (43%) Gaps:58/303 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LNWSYVEHGNML--CNMEFAQEQARYGEGKVLNVTGRLIHITATDNFSD-DYACTPYIRGT---- 129
            :|:|::...::|  |.:..| :....|:..:|             :|.| :...||.:|.:    
plant     1 MNYSWITIMSLLVICKLASA-KVVLIGKNTIL-------------SFDDVEATFTPIVRNSGECG 51

  Fly   130 ---LGAPIP------------DKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLE 179
               :..|:.            .|..:...|:..|.|:|||||:...:......|:|||.....|.
plant    52 ILYVAEPLEACSDITNMAEKRSKYRSSYVLIVLGGCSFEEKVRKAQKAGYKAAIVYNDGYDELLV 116

  Fly   180 KMQIKGKTRNIAAVITYQNIGQDLSLTLDKGY----NVTISIIEGRRGVRTISSLNRTSVLFVSI 240
            .|.......:|..::..:..|:.|     |||    .:.:.:|.| .|:.:.|        .:.|
plant   117 PMAGNSSGVDIHGLLVTRASGEVL-----KGYADQDEMKLWLIPG-FGISSWS--------IMGI 167

  Fly   241 SFIVLMIISLVWLIFYYIQRFRYMQA-KD--QQSRNLCSVTKKAIMKIPTKTGKFSDEKDLDSDC 302
            :||.|:.:|.:....:.::|.:..|: :|  ...:.|..:.:..:..:||:......|:...|..
plant   168 TFISLLAMSAILATCFVVRRHQIRQSVRDLPHGGQGLSCMPRDLLQSMPTEVYSGVLEESSTSVT 232

  Fly   303 CAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRT-CPMCK 344
            |||||:.|...:.:|||||||::|..|||.||...|: ||:||
plant   233 CAICIDDYCVGEKLRILPCKHKYHAVCIDSWLGRCRSFCPVCK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 34/169 (20%)
UPF0233 226..>258 CDD:299753 6/31 (19%)
zf-RING_2 301..344 CDD:290367 22/43 (51%)
AT1G35630NP_174800.2 PA_C_RZF_like 11..155 CDD:239038 32/162 (20%)
zf-RING_2 232..275 CDD:290367 22/42 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.