DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and ATL15

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_173666.1 Gene:ATL15 / 838856 AraportID:AT1G22500 Length:381 Species:Arabidopsis thaliana


Alignment Length:202 Identity:52/202 - (25%)
Similarity:89/202 - (44%) Gaps:45/202 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 CAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEESILEYQ 366
            |.:|:..::..:|:|::| |.|.||..|||.||....|||:|:.:::...|       ||:....
plant   118 CPVCLNEFEDDETLRLIPQCCHVFHPGCIDAWLRSQTTCPLCRANLVPVPG-------ESVSSEI 175

  Fly   367 PDPPQGLALVEARDE---SADLNRSRDFVVDFPRVFVLDSGCVVGAREMLFPCRIPERSQSSLSL 428
            |    |||....::.   ..|.||.|  |:..|...::||....|.:.|      |.:|.|:   
plant   176 P----GLARETGQNSLRTPIDDNRKR--VLTSPDERLIDSVAWTGNQSM------PRKSMST--- 225

  Fly   429 RQARDW--VSLMS-----NKLEEQQGLRSMR-NDEMQQQLLSA---RESARHR----RSRSADGR 478
                .|  ..|.|     .:.||.....::| ..|:..||:::   ::.::.:    :.||:...
plant   226 ----GWKLAELYSPASSPGQPEENLDRYTLRLPQEIHDQLVNSSLGKQGSKGQLALPQERSSVRG 286

  Fly   479 YSTGCFG 485
            :.||..|
plant   287 FRTGSLG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 18/44 (41%)
RING-H2_RNF130-like 302..347 CDD:438330 18/44 (41%)
ATL15NP_173666.1 RAD18 116..>217 CDD:227719 34/111 (31%)
RING-H2_EL5-like 117..160 CDD:438124 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.