DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT1G20823

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_173506.1 Gene:AT1G20823 / 838674 AraportID:AT1G20823 Length:197 Species:Arabidopsis thaliana


Alignment Length:97 Identity:38/97 - (39%)
Similarity:52/97 - (53%) Gaps:10/97 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 KKAIMKIPTKTGKFSDEKDLDSDC---CAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRT 339
            ||.:..:|..|  ||.|.. :|:.   ||||:..:...|.:|:|| |.|.||..|||.||..|.:
plant    87 KKVLQSLPKLT--FSPESP-ESEKFAECAICLAEFSAGDELRVLPQCGHGFHVACIDTWLGSHSS 148

  Fly   340 CPMCK--LDVLKFYGYVFL-GSEESILEYQPD 368
            ||.|:  |.|.:.:....| ||..|.||.:|:
plant   149 CPSCRQILVVARCHKCGGLPGSSSSGLESEPE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 30/73 (41%)
RING-H2_RNF130-like 302..347 CDD:438330 22/50 (44%)
AT1G20823NP_173506.1 RING-H2_EL5-like 110..153 CDD:438124 20/42 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.