DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT1G18760

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_173311.1 Gene:AT1G18760 / 838458 AraportID:AT1G18760 Length:224 Species:Arabidopsis thaliana


Alignment Length:128 Identity:29/128 - (22%)
Similarity:49/128 - (38%) Gaps:42/128 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 MIISLVWLIF---------YYIQRFRYMQAKDQ----------QSRNLC----------SVTKKA 281
            :::||  |||         |.|:.....:.:||          ::.|:.          |:.:|.
plant   102 LLVSL--LIFPNDEPIEEEYEIEEEDLSEEEDQIEEAVRASLEETNNISLRPANKLVVNSLARKI 164

  Fly   282 IMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCK 344
            ..|..:.|.:           |.||:|.:.....:..|||.|||...|:..|...:..||:|:
plant   165 YKKTTSSTER-----------CTICLEEFNDGTKVMTLPCGHEFDDECVLTWFETNHDCPLCR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 29/128 (23%)
RING-H2_RNF130-like 302..347 CDD:438330 15/43 (35%)
AT1G18760NP_173311.1 RING_Ubox 173..219 CDD:473075 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.