DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT1G14200

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_172872.1 Gene:AT1G14200 / 837980 AraportID:AT1G14200 Length:179 Species:Arabidopsis thaliana


Alignment Length:54 Identity:21/54 - (38%)
Similarity:34/54 - (62%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 DEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDV 347
            ::|:.....||||::.:...|....:||||:||..|::.||..|.|||||:.::
plant   100 EDKEKYGGSCAICLDEWSKGDVAAEMPCKHKFHSKCVEEWLGRHATCPMCRYEM 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 21/52 (40%)
RING-H2_RNF130-like 302..347 CDD:438330 20/44 (45%)
AT1G14200NP_172872.1 RING-H2_PA-TM-RING 108..150 CDD:438118 19/41 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.