DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G55970

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_568834.1 Gene:AT5G55970 / 835695 AraportID:AT5G55970 Length:343 Species:Arabidopsis thaliana


Alignment Length:148 Identity:26/148 - (17%)
Similarity:50/148 - (33%) Gaps:70/148 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 LPFTDPEI-TSHYLLNLVVQYYLLIVGLAGFSAAESVLIL----FVTSVAG--YADVLKNKINEM 222
            :|...||: |..|::                   ||:|::    |:|.:..  |:...:..:...
plant   134 MPPPPPEVRTKDYMV-------------------ESILVMIFCCFLTGIIAVVYSHEARTALGRG 179

  Fly   223 NTLLLDAQNSRDRTSVKLKLREIVLLHQRVLEYEDDLDKRYYLNNWVQVASSIFNLTGALFGCYV 287
            :.||....:.:.|:.|                                    :|:|   |||.:|
plant   180 DLLLAQVASRKARSLV------------------------------------LFSL---LFGVFV 205

  Fly   288 SNSFTMYALAITIVIQLF 305
            |.|:.:|     :|:.:|
plant   206 SISWIIY-----VVVAIF 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 11/58 (19%)
HRD1 <237..>347 CDD:227568 12/69 (17%)
RING-H2_RNF130-like 302..347 CDD:438330 1/4 (25%)
AT5G55970NP_568834.1 RING_Ubox 296..341 CDD:473075
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.