DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G43200

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_199134.1 Gene:AT5G43200 / 834338 AraportID:AT5G43200 Length:207 Species:Arabidopsis thaliana


Alignment Length:230 Identity:50/230 - (21%)
Similarity:85/230 - (36%) Gaps:73/230 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 VKHVYQQNAAG----VIIYNDKQVMQLEKMQIKGKTRNIAAVITYQNIGQD-----LSLTL---- 207
            ||.:.|..:.|    |:|   .|..::|:..|..|...:.::.:|.:....     :||||    
plant    12 VKALSQPPSLGFLSTVVI---SQYREVEEFLINNKDNCVTSLGSYPDDSSTCHDPLISLTLPSFK 73

  Fly   208 ---------------DKGYNVTISIIEGRRGVRTISS--LNRTSVLFVSISFIVLMIISLVWLIF 255
                           |....::..|:|.::. :|..|  |.:...||:.:|              
plant    74 PNDVYQHLQTQLHDHDLSEQISCKIVEAQQR-QTSQSVYLPQQPPLFIIVS-------------- 123

  Fly   256 YYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDE----KDLDSDCCAICIEAYKPTDTI 316
                               ..:|.|..:.:|........|    ::.:|..||||:|....:|..
plant   124 -------------------VKLTHKVYVVVPPLATDLDQEMSQGEEEESKTCAICLEELSTSDDY 169

  Fly   317 RILP-CKHEFHKNCIDPWLIE-HRTCPMCKLDVLK 349
            ..|| |.|.||:.|:..|||. :.:||:|:..|.|
plant   170 CELPNCTHCFHEPCLTQWLIRGNNSCPLCRKPVDK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 16/88 (18%)
UPF0233 226..>258 CDD:299753 6/33 (18%)
zf-RING_2 301..344 CDD:290367 18/44 (41%)
AT5G43200NP_199134.1 RING 155..202 CDD:238093 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.