DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment gol and AT5G41450

DIOPT Version :9

Sequence 1:	NP_001163300.1	Gene:	gol / 38006	FlyBaseID:	FBgn0004919	Length:	601	Species:	Drosophila melanogaster
Sequence 2:	NP_198960.1	Gene:	AT5G41450 / 834146	AraportID:	AT5G41450	Length:	164	Species:	Arabidopsis thaliana

Alignment Length:	56	Identity:	24/56 - (42%)
Similarity:	36/56 - (64%)	Gaps:	2/56 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   291 KFSDEKDLDSDC-CAICIEAYKP-TDTIRILPCKHEFHKNCIDPWLIEHRTCPMCK 344
            :|.|.|:..:.. |.||:|.::. .:.|||..|:|.||:.||||||.::.|||.|:
plant    97 EFKDIKEGSNKIFCPICLEEFEDGHEIIRINMCRHVFHRFCIDPWLNQNLTCPNCR 152

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
gol	NP_001163300.1	PA_GRAIL_like	73..217	CDD:239037
		UPF0233	226..>258	CDD:299753
		zf-RING_2	301..344	CDD:290367	20/44 (45%)
AT5G41450	NP_198960.1	zf-RING_2	110..152	CDD:290367	20/41 (49%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1487241at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.920