DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G41430

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_198958.1 Gene:AT5G41430 / 834144 AraportID:AT5G41430 Length:161 Species:Arabidopsis thaliana


Alignment Length:85 Identity:29/85 - (34%)
Similarity:49/85 - (57%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 KDQQSRNLCSVTKKAIMKIPTKTG----KFSD-EKD-LDSDCCAICIEAYKP-TDTIRILPCKHE 324
            :|.::.:|..:..:...||..:..    :|.| ||: .|...|:||:|..:. .:.|||..|:|.
plant    75 QDNETGHLMPLHSQLEFKIGYRASIEEMEFKDIEKEGFDEIGCSICLEELEDGHEIIRIKKCRHV 139

  Fly   325 FHKNCIDPWLIEHRTCPMCK 344
            ||::|||.||.::|:||.|:
plant   140 FHRSCIDSWLKQNRSCPNCR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
UPF0233 226..>258 CDD:299753
zf-RING_2 301..344 CDD:290367 19/43 (44%)
AT5G41430NP_198958.1 zf-RING_2 117..159 CDD:290367 19/41 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.