DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G41400

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_198956.1 Gene:AT5G41400 / 834142 AraportID:AT5G41400 Length:176 Species:Arabidopsis thaliana


Alignment Length:48 Identity:21/48 - (43%)
Similarity:34/48 - (70%) Gaps:3/48 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 SDCCAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHR--TCPMCK 344
            |||||:|:..::..|.||.|. |:|.||::|:|.|::.:.  |||:|:
plant   102 SDCCAVCLHEFENDDEIRRLTNCQHIFHRSCLDRWMMGYNQMTCPLCR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 21/48 (44%)
RING-H2_RNF130-like 302..347 CDD:438330 19/46 (41%)
AT5G41400NP_198956.1 RING-H2_RHA1-like 103..152 CDD:438483 20/47 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.