DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G38895

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001190436.2 Gene:AT5G38895 / 833881 AraportID:AT5G38895 Length:335 Species:Arabidopsis thaliana


Alignment Length:78 Identity:23/78 - (29%)
Similarity:36/78 - (46%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 AKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCI 330
            :|:..::...:.||...|  |.....::|..  |.|.|..|::.|...:...|..|.|.||.:||
plant   250 SKEVYTKGSSTFTKSKTM--PGIEVYYADSD--DEDICPTCLDDYTLENPKIITKCSHHFHLSCI 310

  Fly   331 DPWLIEHRTCPMC 343
            ..|:....|||:|
plant   311 YEWMERSETCPVC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 23/78 (29%)
RING-H2_RNF130-like 302..347 CDD:438330 15/42 (36%)
AT5G38895NP_001190436.2 RING-H2_AIRP1-like 279..327 CDD:438478 17/45 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.