DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G37250

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001330830.1 Gene:AT5G37250 / 833699 AraportID:AT5G37250 Length:208 Species:Arabidopsis thaliana


Alignment Length:60 Identity:24/60 - (40%)
Similarity:37/60 - (61%) Gaps:3/60 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 KTGKFSDEKDLDSDCCAICIEAYKPT--DTIRILP-CKHEFHKNCIDPWLIEHRTCPMCK 344
            :|.:.:|..|.:...|:||:|.:..:  |.|.:|| |.|.||:|||..||...|:||:|:
plant   138 QTMELTDLGDEEETTCSICLEDFSESHDDNIILLPDCFHLFHQNCIFEWLKRQRSCPLCR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 24/60 (40%)
RING-H2_RNF130-like 302..347 CDD:438330 21/46 (46%)
AT5G37250NP_001330830.1 HRD1 <86..>198 CDD:227568 24/60 (40%)
RING-H2_PA-TM-RING 152..197 CDD:438118 20/44 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.