DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AIP2

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_197591.1 Gene:AIP2 / 832215 AraportID:AT5G20910 Length:310 Species:Arabidopsis thaliana


Alignment Length:71 Identity:27/71 - (38%)
Similarity:42/71 - (59%) Gaps:7/71 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 TKKAIMKIPTKTGKFSDEK----DLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHR 338
            :|:.:.|:|...  |::|.    ..:::|| ||.|.....|.::.|||||.||..|:.|||.||.
plant   204 SKEVVEKLPVII--FTEELLKKFGAEAECC-ICKENLVIGDKMQELPCKHTFHPPCLKPWLDEHN 265

  Fly   339 TCPMCK 344
            :||:|:
plant   266 SCPICR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 27/71 (38%)
RING-H2_RNF130-like 302..347 CDD:438330 22/43 (51%)
AIP2NP_197591.1 RING-H2_RNF126-like 229..271 CDD:438329 21/42 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.