DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G20885

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_568404.1 Gene:AT5G20885 / 832212 AraportID:AT5G20885 Length:176 Species:Arabidopsis thaliana


Alignment Length:142 Identity:40/142 - (28%)
Similarity:64/142 - (45%) Gaps:27/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 SSLNRTSVLFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLC-SVTKKAIMKIPTKTGK 291
            |.|..|.:|:.....|.::...|.|::     |:|........|.:.| |::.:||.:..:.| .
plant     8 SGLIVTQLLYKMAVLITVLRWILAWIL-----RYRSRSRSTSSSTSACPSISSQAIKESLSVT-T 66

  Fly   292 FSDEKD----LDSDCCAICIEAYKPTDTIRIL-PCKHEFHKNCIDPWL---------------IE 336
            |.|..:    :.:|.||:|:...:..|.:|.| .|.|.||:.|||.||               ..
plant    67 FRDAAERSPAMINDTCAVCLGDLEDGDEVRELRNCSHMFHRECIDRWLDYECCGGDENNEGEEDN 131

  Fly   337 HRTCPMCKLDVL 348
            |||||:|:..:|
plant   132 HRTCPLCRTPLL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 35/130 (27%)
RING-H2_RNF130-like 302..347 CDD:438330 21/60 (35%)
AT5G20885NP_568404.1 RING_Ubox 79..142 CDD:473075 22/62 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.