DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G01880

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_195808.1 Gene:AT5G01880 / 831691 AraportID:AT5G01880 Length:159 Species:Arabidopsis thaliana


Alignment Length:83 Identity:29/83 - (34%)
Similarity:47/83 - (56%) Gaps:7/83 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 KKAIMKIP-TKTGKFSDEKDLDSDCCAICIEAYKPTDTIRIL-PCKHEFHKNCIDPWLIEHRTCP 341
            |:.:.|.| .:.|  |.|..:.:..||||:..:...:.:|:| ||.|.||.:|||.||:.|.:||
plant    82 KRELKKFPVAEYG--SGEVKIAATECAICLGEFADGERVRVLPPCNHSFHMSCIDTWLVSHSSCP 144

  Fly   342 MCKLDVLKFYGYVFLGSE 359
            .|:..:::.:   ..|||
plant   145 NCRHSLIEVH---VAGSE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 26/69 (38%)
RING-H2_RNF130-like 302..347 CDD:438330 20/45 (44%)
AT5G01880NP_195808.1 RING-H2_EL5-like 104..147 CDD:438124 19/42 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.