DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G15820

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_197086.1 Gene:AT5G15820 / 831439 AraportID:AT5G15820 Length:348 Species:Arabidopsis thaliana


Alignment Length:42 Identity:19/42 - (45%)
Similarity:26/42 - (61%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 CAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCK 344
            ||||.:.....:.::.|||||.:|..||.|||....|||:|:
plant   291 CAICKDEVVFKEKVKRLPCKHYYHGECIIPWLGIRNTCPVCR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 19/42 (45%)
RING-H2_RNF130-like 302..347 CDD:438330 19/42 (45%)
AT5G15820NP_197086.1 RING_Ubox 291..332 CDD:473075 18/40 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.