DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G06490

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_196267.1 Gene:AT5G06490 / 830537 AraportID:AT5G06490 Length:197 Species:Arabidopsis thaliana


Alignment Length:152 Identity:43/152 - (28%)
Similarity:69/152 - (45%) Gaps:44/152 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 VSISFIVLMIISLVWLIFYYI------------------------------QRFRYMQAKDQQSR 272
            :.:|..:||:|:.:.|..||.                              :||.:   :|.:|.
plant    27 IGVSIGILMLITTITLTSYYCTRSHISASPTTTPRTRRRQRESNGTLPPGQERFDF---EDDESD 88

  Fly   273 ----NLCSVTKKAIM---KIPTKTGKFS---DEKDLDSDCCAICIEAYKPTDTIRILP-CKHEFH 326
                .:..:|::.|.   |:|.:..:.|   .::...:.||:||:..||..|.||:|| |.|.||
plant    89 TVVVEVLGLTEEVIKGFPKLPYEEARVSYSLQKESSTTSCCSICLADYKKMDMIRVLPDCNHLFH 153

  Fly   327 KNCIDPWLIEHRTCPMCKLDVL 348
            .||:||||..|.|||:|:...|
plant   154 DNCVDPWLRLHPTCPVCRTSPL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 42/149 (28%)
RING-H2_RNF130-like 302..347 CDD:438330 26/45 (58%)
AT5G06490NP_196267.1 RING-H2_PA-TM-RING 128..171 CDD:438118 25/42 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.