DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G05280

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_196147.1 Gene:AT5G05280 / 830410 AraportID:AT5G05280 Length:176 Species:Arabidopsis thaliana


Alignment Length:154 Identity:41/154 - (26%)
Similarity:74/154 - (48%) Gaps:24/154 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 RTISSLNRTSVLFVSISFIVLM----IISLVWLIFYYIQRFRYMQAKDQQSRNLC-SVTKKAIMK 284
            :.|:|::...|:.::.....|:    |.|::..:....:||...:.....:.|:. .:.|:|:..
plant    32 KNIASMDTHMVIILAALLCALICALGINSVLRCVLRCTRRFTPNEDPVDTNANVAKGIKKRALKV 96

  Fly   285 IPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRTCPMCKLDVL 348
            ||..:  :|.|..:.:..|.||:..:...:|:|:|| |.|.||..|||.||:.|.:||.|:    
plant    97 IPVDS--YSPELKMKATECLICLGDFVEGETVRVLPKCNHGFHVKCIDTWLLSHSSCPTCR---- 155

  Fly   349 KFYGYVFLGSEESILEYQPDPPQG 372
                       :|:||:| .|..|
plant   156 -----------QSLLEHQ-TPANG 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 32/115 (28%)
RING-H2_RNF130-like 302..347 CDD:438330 20/45 (44%)
AT5G05280NP_196147.1 RING-H2_EL5-like 112..155 CDD:438124 19/42 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.