DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT4G38140

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_195527.1 Gene:AT4G38140 / 829970 AraportID:AT4G38140 Length:145 Species:Arabidopsis thaliana


Alignment Length:107 Identity:34/107 - (31%)
Similarity:45/107 - (42%) Gaps:32/107 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 AKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILP-CKHEFHKNC 329
            |.|....||..|             .|.|::..:..||.||:..::..|.:..|| |.|.||.||
plant    38 AHDDDGYNLVGV-------------MFGDKEKEEEICCPICLVEFEAEDAVTHLPRCAHLFHINC 89

  Fly   330 IDPWLIE-HRTCPMCKLDVLKFYGYVFLGSEESILEYQPDPP 370
            |:|||:. |.|||:|:..||                 .|.||
plant    90 IEPWLLRGHLTCPLCRSFVL-----------------APTPP 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 29/82 (35%)
RING-H2_RNF130-like 302..347 CDD:438330 22/46 (48%)
AT4G38140NP_195527.1 RING_Ubox 61..105 CDD:473075 21/43 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.