DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT4G26400

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_194370.2 Gene:AT4G26400 / 828746 AraportID:AT4G26400 Length:356 Species:Arabidopsis thaliana


Alignment Length:241 Identity:53/241 - (21%)
Similarity:95/241 - (39%) Gaps:57/241 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 VMQLEKMQIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVS 239
            ::||    ::|....||:  .|::..:||   |::.     ::::|...:.  .:.|.||:..:.
plant   146 ILQL----LQGIRAGIAS--EYESSDRDL---LNQS-----AVVQGSTSLN--QNRNNTSLSAIG 194

  Fly   240 ISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDLDSDCCA 304
            ..|:...:..|:          .::...|..........|:.:..:||.  |.|:...     |:
plant   195 DYFVGSSLDHLL----------EHLADNDSIRHGSLPARKEVVDNLPTV--KISESLQ-----CS 242

  Fly   305 ICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEESILEYQPDP 369
            ||::.:......:.:||||:||..||.|||..|.:||:|:                  .|..||.
plant   243 ICLDDFDKGSEAKEMPCKHKFHIRCIVPWLELHSSCPVCR------------------YELPPDD 289

  Fly   370 PQGLALVEARDESADLNRSRDFVVDFPRVFVLDSGCVVGAREMLFP 415
            ...:..|..|..:.::|.|.:.|.|..|      ...|..|...||
plant   290 ETKVNPVRPRTRTLEINVSNENVEDDAR------NSNVSERRFSFP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 9/41 (22%)
HRD1 <237..>347 CDD:227568 26/109 (24%)
RING-H2_RNF130-like 302..347 CDD:438330 18/44 (41%)
AT4G26400NP_194370.2 zinc_ribbon_9 4..35 CDD:433910
RING-H2_RNF181 240..285 CDD:438331 18/67 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.