DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RHB1A

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_567171.1 Gene:RHB1A / 828093 AraportID:AT4G00335 Length:190 Species:Arabidopsis thaliana


Alignment Length:80 Identity:24/80 - (30%)
Similarity:38/80 - (47%) Gaps:7/80 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 CSVTKKAIMKIPTKTGKFSDEK------DLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPW 333
            |.....:::..|.|: .||..:      |.:.|||.||.|.|...:......|:||||.:|:..|
plant   106 CKTLASSVILSPRKS-DFSKHQGLKILVDEEEDCCPICFEDYDVENPRLTTKCEHEFHLSCLLEW 169

  Fly   334 LIEHRTCPMCKLDVL 348
            :.....||:|..:|:
plant   170 IERSDRCPICDKEVV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 23/77 (30%)
RING-H2_RNF130-like 302..347 CDD:438330 16/44 (36%)
RHB1ANP_567171.1 RING-H2_AIRP1-like 135..183 CDD:438478 17/47 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.