DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RHA1A

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_192876.1 Gene:RHA1A / 826739 AraportID:AT4G11370 Length:159 Species:Arabidopsis thaliana


Alignment Length:122 Identity:35/122 - (28%)
Similarity:55/122 - (45%) Gaps:24/122 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LMIISLVWLIFYYIQRFR--------YM---QAKDQQSRNLCSVTKKAIMK--------IPTKTG 290
            |.|.|.:..|.|.|..||        |:   :..|....:...:|:.|:..        ||..  
plant    11 LQIPSYILKILYVIGFFRDIVDALCPYIGLPRFLDHNETSAPDLTRHALSTSASLANELIPVV-- 73

  Fly   291 KFSDEKDLDSDCCAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHR--TCPMCK 344
            :|||......|||.:|:..::..|.:|.|| |.|.||..|:|.|::::.  .||:|:
plant    74 RFSDLPTDPEDCCTVCLSDFESDDKVRQLPKCGHVFHHYCLDRWIVDYNKMKCPVCR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 35/122 (29%)
RING-H2_RNF130-like 302..347 CDD:438330 17/46 (37%)
RHA1ANP_192876.1 RING-H2_RHA1-like 83..133 CDD:438483 18/48 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.