DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT4G09110

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_192650.1 Gene:AT4G09110 / 826489 AraportID:AT4G09110 Length:302 Species:Arabidopsis thaliana


Alignment Length:302 Identity:74/302 - (24%)
Similarity:115/302 - (38%) Gaps:75/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 ISFIVLMIISLVWLIFYYIQRFRY---MQAKDQQ---SRNLCSVTKKAIMKIP---------TKT 289
            |:.|||.|...:.::..::.:..|   ::|..|:   ||....:.|:.:...|         .|.
plant    52 IAIIVLAIFISLSMVACFLHKTFYRAEVEAASQEVFHSRARRGLEKELVESFPIFLYSEVKGLKI 116

  Fly   290 GKFSDEKDLDSDCCAICIEAYKPTDTIRIL-PCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGY 353
            ||...|       ||||:..:...:|:|.: ||.|.||.||||.||....|||.|:.::....| 
plant   117 GKGGVE-------CAICLSEFVDKETLRWMPPCSHTFHANCIDVWLSSQSTCPACRANLSLKPG- 173

  Fly   354 VFLGSEESILEYQPDPPQGLAL-VEARDESADLNRSRDFVVDFPRVFVLDSGCVVGAREMLFPCR 417
                      |..|.|...|.. .|.|||.:.|.                    :|.....|..:
plant   174 ----------ESYPYPITDLETGNEQRDEHSLLQ--------------------LGTNLDRFTLQ 208

  Fly   418 IPERSQSSL-SLRQARDWVSLMSNKLEEQQGLRSMRNDEMQQQLLSARESARHRRSRSADGRYST 481
            :||..|..| ||...|.....:...:..:||.||        .....|::.|...|.|..  :|.
plant   209 LPEEMQRQLVSLNLIRTSNMTLPRAMSSRQGYRS--------GFSHGRQTLRRAISMSLS--FSL 263

  Fly   482 GCFGGRQRQPSVLVSSLGQPQLHSEVAQMQ-RSNSSQALKHL 522
                    |.:.:.|::|:..|..|.:|.: :....|:.:||
plant   264 --------QAASVRSTVGRDDLVLETSQAKDKDLCEQSFQHL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
UPF0233 226..>258 CDD:299753 5/17 (29%)
zf-RING_2 301..344 CDD:290367 20/43 (47%)
AT4G09110NP_192650.1 zf-RING_2 122..165 CDD:290367 21/49 (43%)
zf-rbx1 <123..165 CDD:289448 20/41 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.