DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and BRH1

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_191705.1 Gene:BRH1 / 825319 AraportID:AT3G61460 Length:170 Species:Arabidopsis thaliana


Alignment Length:130 Identity:35/130 - (26%)
Similarity:61/130 - (46%) Gaps:28/130 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFS------- 293
            |||....|:..|.::|:.||.::....::: .||...:..|..    .:||.....||       
plant    15 LFVQTLSILGFIRTIVFSIFRFLGLSDFLE-MDQTWPDYTSYP----TRIPETRSPFSALLIREI 74

  Fly   294 -----------DEKDLDSDCCAICIEAYKPTDTIRIL-PCKHEFHKNCIDPWLIEH--RTCPMCK 344
                       ..:||..: ||:|:..::....||.| .|:|.||::|:|.|: :|  :|||:|:
plant    75 LPVIKFEELTNSGEDLPEN-CAVCLYEFEGEQEIRWLRNCRHIFHRSCLDRWM-DHDQKTCPLCR 137

  Fly   345  344
            plant   138  137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 34/129 (26%)
RING-H2_RNF130-like 302..347 CDD:438330 18/46 (39%)
BRH1NP_191705.1 RING_Ubox 94..140 CDD:473075 18/45 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.