DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT3G61180

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_567110.1 Gene:AT3G61180 / 825290 AraportID:AT3G61180 Length:379 Species:Arabidopsis thaliana


Alignment Length:143 Identity:41/143 - (28%)
Similarity:66/143 - (46%) Gaps:33/143 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 VLFVSISFIVLMIISL--------VWLIFYYIQ--------------RFRYMQAKDQQSRN-LCS 276
            |:||.|...|..:|.:        :..|.|.:.              :|:::..|:.:..| ...
plant   232 VMFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGAPDEEIERLLKFKFLTVKNSEKVNGEIR 296

  Fly   277 VTKKAIMKIPTKTGKFSDEKD----LDSDC-CAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIE 336
            .|:..||     ||..::.:.    |..|. |:||:.||:....:|.|||:|.||..|:|.||..
plant   297 ETQGGIM-----TGLDTESQTERMLLSEDAECSICLCAYEDGVELRELPCRHHFHSLCVDKWLRI 356

  Fly   337 HRTCPMCKLDVLK 349
            :.|||:||.::||
plant   357 NATCPLCKFNILK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 38/137 (28%)
RING-H2_RNF130-like 302..347 CDD:438330 21/45 (47%)
AT3G61180NP_567110.1 RING_Ubox 322..367 CDD:473075 21/44 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.