DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RDUF1

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_190246.1 Gene:RDUF1 / 823815 AraportID:AT3G46620 Length:395 Species:Arabidopsis thaliana


Alignment Length:55 Identity:22/55 - (40%)
Similarity:32/55 - (58%) Gaps:7/55 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 SDC-------CAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDV 347
            |||       ||:|.|.::.....|.:||||.||.:||.|||....:||:|:.::
plant   205 SDCHTKAEANCAVCTEVFEAGIEGREMPCKHIFHGDCIVPWLSIRNSCPVCRFEL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 22/53 (42%)
RING-H2_RNF130-like 302..347 CDD:438330 20/51 (39%)
RDUF1NP_190246.1 zinc_ribbon_9 30..65 CDD:433910
RING_Ubox 214..256 CDD:473075 18/41 (44%)
DUF1117 274..393 CDD:399509
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.