DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT3G19910

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_566651.1 Gene:AT3G19910 / 821529 AraportID:AT3G19910 Length:340 Species:Arabidopsis thaliana


Alignment Length:78 Identity:27/78 - (34%)
Similarity:45/78 - (57%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 QSRNLCSVTKKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWL 334
            :||.|.:.|   |..:|:|..|..|.::..::.|.||...|:..:.:.:|||||.:|..||:.||
plant   258 ESRGLSADT---IASLPSKRYKEGDNQNGTNESCVICRLDYEDDEDLILLPCKHSYHSECINNWL 319

  Fly   335 IEHRTCPMCKLDV 347
            ..::.||:|..:|
plant   320 KINKVCPVCSAEV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 26/76 (34%)
RING-H2_RNF130-like 302..347 CDD:438330 17/44 (39%)
AT3G19910NP_566651.1 RING-H2_BB-like 282..333 CDD:438477 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.