DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT3G02290

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001325920.1 Gene:AT3G02290 / 821179 AraportID:AT3G02290 Length:237 Species:Arabidopsis thaliana


Alignment Length:83 Identity:22/83 - (26%)
Similarity:38/83 - (45%) Gaps:9/83 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 DQQSRNLCSVTKKAIMKIPTKTGK--FSDEKDL-----DSDCCAICIEAYKPTDTIRILPCKHEF 325
            |:.|:.  ..:.|:.::|.....|  .:|.:::     |.|.|..|:|.|...:...:..|.|.|
plant   141 DKDSKE--EYSSKSSLRILRSRSKSIMADSENMYILSEDEDVCPTCLEEYTSENPKIVTKCSHHF 203

  Fly   326 HKNCIDPWLIEHRTCPMC 343
            |.:||..|:.....||:|
plant   204 HLSCIYEWMERSENCPVC 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 22/83 (27%)
RING-H2_RNF130-like 302..347 CDD:438330 14/42 (33%)
AT3G02290NP_001325920.1 RING-H2_AIRP1-like 177..224 CDD:438478 16/45 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.