DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT3G10910

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_187702.1 Gene:AT3G10910 / 820261 AraportID:AT3G10910 Length:181 Species:Arabidopsis thaliana


Alignment Length:181 Identity:47/181 - (25%)
Similarity:76/181 - (41%) Gaps:53/181 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 TSVLFVSISFIVLMIISL-----VWLIFYYIQRFRYMQAKDQQSRN----------LCSVT---K 279
            |:::.:..:.:..:|.:|     :..:....:||    ..|.|..|          |.:.|   |
plant    31 TNMVIILAALLCALICALSLNSALRCVLRITRRF----TSDDQVSNASNANANLGRLAAATGLKK 91

  Fly   280 KAIMKIPTKTGKF-SDEKDLDSDCCAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRTCPM 342
            :|:.:||  .|.: |...|:.:..|.||:..::..:.:|:|| |.|.||..|||.||:...:||.
plant    92 QALKQIP--VGLYGSGIIDMKATECLICLGDFEDGEKVRVLPKCNHGFHVRCIDTWLLSRSSCPT 154

  Fly   343 CKLDVLKFYGYVFLGSEESILEYQPDPPQGLALVEARDESADLNRSRDFVV 393
            |:               :|:|..||.|    ..|..|||        |.||
plant   155 CR---------------QSLLLEQPSP----MAVSRRDE--------DMVV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 34/129 (26%)
RING-H2_RNF130-like 302..347 CDD:438330 18/45 (40%)
AT3G10910NP_187702.1 RING-H2_EL5-like 113..156 CDD:438124 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.