DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT2G44330

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_181961.1 Gene:AT2G44330 / 819040 AraportID:AT2G44330 Length:180 Species:Arabidopsis thaliana


Alignment Length:129 Identity:40/129 - (31%)
Similarity:65/129 - (50%) Gaps:17/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 DQQSRNLCSVTKKAIMKIPTK--TGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCI 330
            |::|:.|..:.....:||.:.  :...||:..|.   ||||.|.:...::.|.|||.|.:|.:||
plant    62 DEESQFLDPMESLPTIKISSSMLSSASSDDSALP---CAICREDFVVGESARRLPCNHLYHNDCI 123

  Fly   331 DPWLIEHRTCPMCKLDVLKFYGYVFLGSEESILEYQPDPPQGLALVEARDESA----DLNRSRD 390
            .|||..|.:||:|::::     .|....::|.|:...|   .|.|.:..:|.|    ||.:|.|
plant   124 IPWLTSHNSCPLCRVEL-----PVASSEDDSGLDMWFD---ALNLEDDLEEEAGVTLDLEQSLD 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 28/80 (35%)
RING-H2_RNF130-like 302..347 CDD:438330 20/44 (45%)
AT2G44330NP_181961.1 RING_Ubox 95..137 CDD:473075 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.