DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT2G42350

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_181764.1 Gene:AT2G42350 / 818836 AraportID:AT2G42350 Length:217 Species:Arabidopsis thaliana


Alignment Length:160 Identity:43/160 - (26%)
Similarity:72/160 - (45%) Gaps:35/160 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 SSLNRTSVLFV--SISFIVLMIISLVWLIFYYI------------QRFRYMQAKDQQSRNLCSVT 278
            :|.:.:|.:|:  ::||.:::||..|    ||:            |...:........|.|.|: 
plant    20 TSYDASSKIFLVTTVSFSIIIIIVFV----YYLYAKFVLHRRSAFQDLSFSVVSQPPKRGLDSL- 79

  Fly   279 KKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRTCPM 342
              .|..:||..  ...:.|:....||:|:...:..|..|:|| |||.||.:|:|.||....|||:
plant    80 --VIASLPTFV--VGIKNDVAGTECAVCLSLLEEKDNARMLPNCKHVFHVSCVDTWLTTQSTCPV 140

  Fly   343 CKLDVLKFYGYVFLGSEESILEYQPDPPQG 372
            |:.:           :|.|....:|:|.:|
plant   141 CRTE-----------AEPSHPRLEPEPREG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 36/124 (29%)
RING-H2_RNF130-like 302..347 CDD:438330 20/45 (44%)
AT2G42350NP_181764.1 RING-H2_EL5-like 99..142 CDD:438124 19/42 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.