DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RHC1A

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_565942.1 Gene:RHC1A / 818680 AraportID:AT2G40830 Length:328 Species:Arabidopsis thaliana


Alignment Length:70 Identity:22/70 - (31%)
Similarity:40/70 - (57%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 KKAIMKIPTKTGKFSDEKDLDSDC-CAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPM 342
            :.||..:||.  |.:......||. |.:|.:.::.....:.:||.|.:|.:||.|||::|.:||:
plant   167 RSAIDALPTI--KIAQRHLRSSDSNCPVCKDEFELGSEAKQMPCNHIYHSDCIVPWLVQHNSCPV 229

  Fly   343 CKLDV 347
            |:.::
plant   230 CRQEL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 22/68 (32%)
RING-H2_RNF130-like 302..347 CDD:438330 15/45 (33%)
RHC1ANP_565942.1 zinc_ribbon_9 6..37 CDD:433910
RING-H2_RNF126-like 189..231 CDD:438329 14/41 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.