DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT2G35420

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_181085.2 Gene:AT2G35420 / 818108 AraportID:AT2G35420 Length:254 Species:Arabidopsis thaliana


Alignment Length:145 Identity:38/145 - (26%)
Similarity:73/145 - (50%) Gaps:25/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 TISSLNRTSVLFVSISFIVLMIISLVWLI-----FYYIQRFRYMQAKDQQSRNLCSVTKKAIMKI 285
            :|.|:..|:| |.|:|..|.::::.|.|.     |:.:..::::..:...:.||.......::.:
plant     6 SIDSIPATAV-FPSVSMPVTVVLTGVLLFVIFAGFFSLFLWQFLLNRLFTTWNLQRTPYGDLIHV 69

  Fly   286 ---PTKTG--------------KFSDEKDLDSDCCAICIEAYKPTDTIRILP-CKHEFHKNCIDP 332
               |..||              ..:.:|:..:: ||||:..:...||:|::. |:|.||.||||.
plant    70 ATPPENTGLDPFIIRSFPVFHYSSATKKNHGTE-CAICLSEFSDEDTVRLITVCRHPFHSNCIDL 133

  Fly   333 WLIEHRTCPMCKLDV 347
            |...|:|||:|:.::
plant   134 WFELHKTCPVCRCEL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 34/132 (26%)
RING-H2_RNF130-like 302..347 CDD:438330 21/45 (47%)
AT2G35420NP_181085.2 RING-H2_PA-TM-RING 102..145 CDD:438118 20/43 (47%)
rad18 103..>193 CDD:273165 21/46 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.