DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT2G29840

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_180545.2 Gene:AT2G29840 / 817534 AraportID:AT2G29840 Length:293 Species:Arabidopsis thaliana


Alignment Length:111 Identity:26/111 - (23%)
Similarity:51/111 - (45%) Gaps:19/111 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 LIFYYIQRFRY-----------------MQA--KDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDL 298
            ::|:::.|:.:                 :||  .:..:..|...:|.|:..:..||.|.:.:...
plant   175 VLFHWLPRYEHDFDHQTEEAFHPQFEQVLQASFNETNTARLKPASKLAVESLNRKTYKKASDVVG 239

  Fly   299 DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCK 344
            :::.|:||:|.:....:|..|||.|||...|...|...:..||:|:
plant   240 ENEMCSICLEEFDDGRSIVALPCGHEFDDECALKWFETNHDCPLCR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 26/111 (23%)
RING-H2_RNF130-like 302..347 CDD:438330 16/43 (37%)
AT2G29840NP_180545.2 zf-RING_2 243..285 CDD:433370 15/41 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.