DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RHA3A

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_179337.1 Gene:RHA3A / 816251 AraportID:AT2G17450 Length:185 Species:Arabidopsis thaliana


Alignment Length:107 Identity:35/107 - (32%)
Similarity:50/107 - (46%) Gaps:19/107 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 IISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKT--------GKFSDEKDLDSDCC 303
            ::...||       .|:....|..|.|. .:.|||:..:|..|        |..::|.  ||..|
plant    48 VVRCAWL-------RRFTAGGDSPSPNK-GLKKKALQSLPRSTFTAAESTSGAAAEEG--DSTEC 102

  Fly   304 AICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRTCPMCK 344
            |||:..:...:.||:|| |.|.||..|||.||:...:||.|:
plant   103 AICLTDFADGEEIRVLPLCGHSFHVECIDKWLVSRSSCPSCR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 35/107 (33%)
RING-H2_RNF130-like 302..347 CDD:438330 20/44 (45%)
RHA3ANP_179337.1 RING-H2_EL5-like 101..144 CDD:438124 19/42 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.