DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and rnf13

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_957338.1 Gene:rnf13 / 793981 ZFINID:ZDB-GENE-040426-772 Length:377 Species:Danio rerio


Alignment Length:442 Identity:112/442 - (25%)
Similarity:183/442 - (41%) Gaps:114/442 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GMEDRIAVDVYN------YAFLNWSYVEHGNMLCNME-----FAQEQARYG-----EGKVLNVTG 105
            ||....|..:|.      :||||...||......:.:     |....||:|     ||    :.|
Zfish     6 GMLMLSATQIYTIFTVQIFAFLNLLPVEADISAYSFDNKTENFDDLPARFGYRLPSEG----LKG 66

  Fly   106 RLIHITATDNFSDDYACTPYIRGTLGAPIPDK---GETWIALVRRGRCTFEEKVKHVYQQNAAGV 167
            .||      ....:.||.|.      .|.|.:   ...:|.|:||..|.|:.||.|..:......
Zfish    67 FLI------GARPENACVPI------EPPPQRENLSSAFIVLIRRFDCNFDIKVLHAQKAGYKAA 119

  Fly   168 IIYN----DKQVMQLEKMQIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTIS 228
            |::|    |...|..|.:.|. |..:|.:|.    ||::.:.:|.:.|     |.|  :|...|.
Zfish   120 IVHNVDSDDLISMGSEDLDIL-KQIDIPSVF----IGEEAANSLKEDY-----IYE--KGGHVIL 172

  Fly   229 SLNRTSVL-FVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKF 292
            ..:.:..| :..|.|::::.|.|:.::.:.|.:|...:.:.::||    :.|..:.|:|....|.
Zfish   173 MPDFSLPLEYYLIPFLIIVGICLILIVVFMITKFVQDRHRARRSR----LRKDQLKKLPIHKFKK 233

  Fly   293 SDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIE-HRTCPMCKLDVLKFYG---- 352
            .|..|:    ||||::.|:..:.:|:|||.|.:|..|:||||.: .:|||:||..|:...|    
Zfish   234 GDSYDV----CAICLDEYEEGERLRVLPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSDGDSES 294

  Fly   353 ---YVFLGSEESILEYQPDPP--QGLALVEAR---DESADLNR----SRDFVVDFPRVFVLDSGC 405
               .|..|.|::  |...:.|  :.||...|.   ..||.|::    |.|:              
Zfish   295 DSDSVDSGGEDN--EVSENTPLLRSLASTSAHSFGSMSASLSQHDAGSSDY-------------- 343

  Fly   406 VVGAREMLFPCRIPERSQSSLSLRQARDWVSLMSNKLEEQQGLRSMRNDEMQ 457
                         .|||.||    .:.:.|::.:..::.|||    |.|:.:
Zfish   344 -------------DERSDSS----DSEEEVTVETVVVQLQQG----RPDDTE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 39/160 (24%)
UPF0233 226..>258 CDD:299753 6/32 (19%)
zf-RING_2 301..344 CDD:290367 19/43 (44%)
rnf13NP_957338.1 PA_C_RZF_like 23..180 CDD:239038 46/184 (25%)
zf-RING_2 238..282 CDD:290367 20/47 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.