DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and znrf3

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001072864.1 Gene:znrf3 / 780325 XenbaseID:XB-GENE-5937936 Length:853 Species:Xenopus tropicalis


Alignment Length:257 Identity:60/257 - (23%)
Similarity:114/257 - (44%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 GAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEKMQIKGKT-----RNI 190
            ||.|..:||. :.:...|.|...:: :.:|:....||:.....::.....:.:.||.     |..
 Frog    62 GATISAEGEI-VQMHPLGLCNNNDE-EDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGA 124

  Fly   191 AAVITYQNIGQDLSLTLDKGYNVTIS----IIEGRRGVRTISSLNR----------------TSV 235
            .|||...:...|....|::|....:.    .::|...::.::.:|:                |..
 Frog   125 TAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHRPPRQPTEY 189

  Fly   236 LFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDLDS 300
            ..:.|.....:::|||.||.  :.:.:..|.:.|.|.|..:|  :|:.|:.|:..|...:...:.
 Frog   190 FDMGIFLAFFVVVSLVCLIL--LIKIKLKQRRSQNSMNRMAV--QALEKMETRKFKAKGKVPREG 250

  Fly   301 DC-------------CAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLK 349
            .|             ||||:|.|...:.:|::||.|.|||.|:||||:::.|||.|:.::::
 Frog   251 SCGGLDTLSSSSTSDCAICLEKYIDGEELRVIPCTHRFHKRCVDPWLLQNHTCPHCRHNIIE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 19/94 (20%)
UPF0233 226..>258 CDD:299753 8/47 (17%)
zf-RING_2 301..344 CDD:290367 22/55 (40%)
znrf3NP_001072864.1 ZNRF_3_ecto 74..180 CDD:375639 16/106 (15%)
RING-H2_ZNRF3 266..309 CDD:319713 22/42 (52%)
RING-H2 finger (C3H2C3-type) 266..306 CDD:319713 21/39 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 583..629
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 650..673
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..713
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 834..853
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.