DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and TTC3

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_016883947.1 Gene:TTC3 / 7267 HGNCID:12393 Length:2081 Species:Homo sapiens


Alignment Length:135 Identity:33/135 - (24%)
Similarity:59/135 - (43%) Gaps:18/135 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 VRTISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVT--------KK 280
            ::.:.|.|:.|:..:||..||..:..   .|....::.:....||:::....|.|        ..
Human  1923 IKKVRSKNKNSLSGLSIDEIVQRVTE---HILDEQKKKKPNPGKDKRTYEPSSATPVTRSSQGSP 1984

  Fly   281 AIMKIPTKTGKFSDEKD------LDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRT 339
            :::..|:...|....:|      |.:..|.||.|.:| :..:|:|.|.|::||.|...||.....
Human  1985 SVVVAPSPKTKGQKAEDVPVRIALGASSCEICHEVFK-SKNVRVLKCGHKYHKGCFKQWLKGQSA 2048

  Fly   340 CPMCK 344
            ||.|:
Human  2049 CPACQ 2053

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
UPF0233 226..>258 CDD:299753 8/31 (26%)
zf-RING_2 301..344 CDD:290367 16/42 (38%)
TTC3XP_016883947.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.