DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Rnf215

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_082135.2 Gene:Rnf215 / 71673 MGIID:1918923 Length:379 Species:Mus musculus


Alignment Length:327 Identity:67/327 - (20%)
Similarity:126/327 - (38%) Gaps:100/327 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EQARYG--EGKVLNVTGRLIHITATDNFSDDYACTPYIRGTLGAPIPDKGETWIALVRRGRCTFE 153
            |..|.|  :|....:.|||:.:...|...:               ||..|  |||:...|:    
Mouse    77 EGVRIGPEDGPEPLLGGRLLLMDVVDAEQE---------------IPVDG--WIAVAYVGK---- 120

  Fly   154 EKVKHVYQQN-AAGVIIYNDKQVMQLEKMQIKGKTRNIAAVITYQNIGQ-DLS-------LTLDK 209
            |:|...:|:| .:....|....|.|:.:....|.:..:..::.:..:.: |:|       :.|..
Mouse   121 EQVAQFHQENQGSSQKAYPKALVQQMRRALFLGASALLLLILNHSVVRELDVSQLLLRPVIVLHY 185

  Fly   210 GYNVT---ISIIEGRRGVRTISSLNRTS-------VLFVSIS----------------------- 241
            ..|||   .::::..:....|||....|       .|:.:..                       
Mouse   186 SSNVTKLLEALLQRTQATAEISSGESLSANIEWKLTLWTTCGLSKDGYGGWQDLVCLGGAQAQEQ 250

  Fly   242 ------FIVLMIISLVWLIFYYIQRFRYMQAKDQQS-------------RNLCSV------TKKA 281
                  :..:::::::......:|..|....::||.             |.|.|:      ..:|
Mouse   251 KPLQQLWNAILLVAMLLCTGLVVQAQRQASRQNQQEPGGQEDLFKRRVVRRLASLKTRRCRLSRA 315

  Fly   282 IMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLD 346
            ...:|          :..::.||:|::.:.....:|:||||||||::|:||||:..:|||:||.:
Mouse   316 AHSLP----------EPGTETCAVCLDYFCNKQWLRVLPCKHEFHRDCVDPWLMLQQTCPLCKFN 370

  Fly   347 VL 348
            ||
Mouse   371 VL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 29/139 (21%)
UPF0233 226..>258 CDD:299753 5/67 (7%)
zf-RING_2 301..344 CDD:290367 20/42 (48%)
Rnf215NP_082135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..63
zf-RING_2 325..368 CDD:290367 20/42 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.