DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Znrf3

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_038948772.1 Gene:Znrf3 / 685487 RGDID:1593771 Length:913 Species:Rattus norvegicus


Alignment Length:511 Identity:112/511 - (21%)
Similarity:196/511 - (38%) Gaps:155/511 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SDDYACTPYIRG------TLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQV 175
            |.||  |.:..|      ..||.:..:||. :.:...|.|...:: :.:|:....||:.....::
  Rat    68 SGDY--TTHTTGLTGRFSRAGAMLSAEGEI-VQMHPLGLCNNNDE-EDLYEYGWVGVVKLEQPEL 128

  Fly   176 MQLEKMQIKGKT-----RNIAAVITYQNIGQDLSLTLDKG----YNVTISIIEGRRGVRTISSLN 231
            .....:.:.||.     |...|||...:...:....|::|    ....:..::|...|:.::.:|
  Rat   129 DPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAVKLMNIVN 193

  Fly   232 RTSV------------------LFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVT 278
            :..|                  :.:.::|.|  ::|||.||.  :.:.:..|.:.|.|.|..:| 
  Rat   194 KQKVARARIQHLPPRQPTEYFDMGIFLAFFV--VVSLVCLIL--LVKIKLKQRRSQNSMNRLAV- 253

  Fly   279 KKAIMKIPTKTGKFSDEKD---------LD-------SDCCAICIEAYKPTDTIRILPCKHEFHK 327
             :|:.|:.|:  ||:.:..         ||       || ||||:|.|...:.:|::||.|.||:
  Rat   254 -QALEKMETR--KFNSKSKGRREGSCGALDTLSSGSTSD-CAICLEKYIDGEELRVIPCTHRFHR 314

  Fly   328 NCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEESILEYQPDPPQGLALVEARDESADLNRSRDFV 392
            .|:||||::|.|||.|:               .:|:|.:.:|  |...|    |:::|.|.|   
  Rat   315 KCVDPWLLQHHTCPHCR---------------HNIIEQKGNP--GAVCV----ETSNLTRGR--- 355

  Fly   393 VDFPRVFVLDSGCVVGAREMLFPCRI---------PERSQSSLSLRQARDWVSLMSNKLEEQQGL 448
              .|||.:          .:.:|.|:         |.|:    |:....:.|:|::.....:|.|
  Rat   356 --HPRVTL----------PVHYPGRVHRTNAIPAYPTRT----SMDSHGNPVTLLTMDRHGEQNL 404

  Fly   449 RSMRND---------EMQQQLLSARESARH---------RRSRSADGRYS-TGCFG--------- 485
            .|.:..         .:...|...|.|..|         ||.:.:...:| ..||.         
  Rat   405 YSPQTPTYVRGYPPLHLDHTLAPHRCSLEHRAYSPAHPFRRPKFSSRSFSKAACFSQYETMYQHY 469

  Fly   486 --------GRQRQPSVLVSSLGQPQLHSEVAQMQRSNSS---QALKHLTDAAHAQS 530
                    .::.||...|:..||.:     |......||   ..:.|:...||.:|
  Rat   470 YFQGLSYPEQESQPVPSVTPRGQSR-----AFPPSGGSSLLFPTMVHMAPPAHVES 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 22/114 (19%)
UPF0233 226..>258 CDD:299753 9/49 (18%)
zf-RING_2 301..344 CDD:290367 22/42 (52%)
Znrf3XP_038948772.1 ZNRF_3_ecto 98..204 CDD:408039 17/106 (16%)
RING-H2_ZNRF3 289..333 CDD:319713 23/59 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.