DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Pja1

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_006257167.1 Gene:Pja1 / 683077 RGDID:1591532 Length:623 Species:Rattus norvegicus


Alignment Length:338 Identity:65/338 - (19%)
Similarity:115/338 - (34%) Gaps:114/338 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FAQEQ-ARYGEGKVLNVTGRLIHITATD--NFSDDYACTPYIRGTLGAPIPDKGETWIALVRRGR 149
            :|::| ||..:.|...|:.|...:...|  .:||||  ..|....     .|..:.|:|.:||..
  Rat   312 YAEDQDARNEQAKPEKVSRRRRTMADPDFWAYSDDY--YRYYEED-----SDSDKEWMAALRRKY 369

  Fly   150 CTFEEKVKHVYQQNAAG----VIIYNDKQVMQLEKMQIKGKTRNIAA---------------VIT 195
            .:.::      .|:::|    .:...:.|    |..|.:|......|               .:.
  Rat   370 RSRDQ------PQSSSGESWEPLPGKEDQ----EPQQARGNVNTAGAGSLAGAGSNGSGYPEEVQ 424

  Fly   196 YQNIGQDLSLTLDKG------YNVTIS------------------IIEGRRGVRTISSLNR---- 232
            ..::.::...:|::|      ||...|                  :::|...:...||::.    
  Rat   425 EPSLQEEEQASLEEGEIPWLRYNENESSSEGDNESTHELMQPGMFMLDGNNNLEDDSSVSEDLEV 489

  Fly   233 ---------------TSVLFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSV----- 277
                           .::.:|...|:..|.:           ..|..||.:....:|.|:     
  Rat   490 DWSLFDGFADGLGVAEAISYVDPQFLTYMAL-----------EERLAQAMETALAHLESLAVDVE 543

  Fly   278 ------TKKAIMKIP-----TKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCID 331
                  :|::|..:|     ...|....|.     ||.||...|...:....|||.|.|||.|:.
  Rat   544 VANPPASKESIDALPEILVTEDHGAVGQEM-----CCPICCSEYVKGEVATELPCHHYFHKPCVS 603

  Fly   332 PWLIEHRTCPMCK 344
            .||.:..|||:|:
  Rat   604 IWLQKSGTCPVCR 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 30/174 (17%)
UPF0233 226..>258 CDD:299753 5/50 (10%)
zf-RING_2 301..344 CDD:290367 18/42 (43%)
Pja1XP_006257167.1 zf-RING_2 575..616 CDD:290367 17/40 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.