DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Rnf148

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001178011.1 Gene:Rnf148 / 681407 RGDID:1595417 Length:316 Species:Rattus norvegicus


Alignment Length:234 Identity:87/234 - (37%)
Similarity:124/234 - (52%) Gaps:21/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 ACTPYIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYN----DKQVMQLEKM 181
            ||:|....:.    ||:.::|:||:.||.|||..|:....::.|.||||||    ..:|.   .|
  Rat    98 ACSPLTNFSR----PDQADSWLALIERGGCTFTHKINVAAEKGANGVIIYNYPGTGNKVF---PM 155

  Fly   182 QIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISFIVLM 246
            ..:| |.||.||:.....|.:|...:.:|..|||.|..||..:..:|.       :| :|....:
  Rat   156 SHQG-TENIVAVMIGNLKGMELLHLIQQGVYVTIII
EVGRMHMPWLSH-------YV-MSLFTFL 211

  Fly   247 IISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSD-EKDLDSDCCAICIEAY 310
            ..::.:|..|...|.|...:..::.|.:.|..||||.::..:..|..| |.|.:.|.|.:|.:.|
  Rat   212 AATVAYLFLYCAWRPRAPNSSTRRQRQIKSDVKKAIGQLQLRVLKEGDKELDPNEDSCVVCFDIY 276

  Fly   311 KPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLK 349
            |..|.||||.|||.|||.||||||:.||||||||.|:|:
  Rat   277 KAQDVIRILTCKHFFHKTCIDPWLLAHRTCPMCKCDILR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 35/99 (35%)
UPF0233 226..>258 CDD:299753 5/31 (16%)
zf-RING_2 301..344 CDD:290367 28/42 (67%)
Rnf148NP_001178011.1 PA_GRAIL_like 56..190 CDD:239037 35/99 (35%)
zf-RING_2 267..310 CDD:290367 28/42 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11661
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.980

Return to query results.
Submit another query.